Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DK60

Protein Details
Accession A0A0D0DK60    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20IKTSKQCKEKWSQVRKTYVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 6.333, cyto 6, cyto_pero 3.999
Family & Domain DBs
Amino Acid Sequences IKTSKQCKEKWSQVRKTYVIVHKICNASGLMYSLEHGANIGPQDEAVWDKFIKQNPGEKMFKWKGWCFYDKMKVLMPSKGKGSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.7
4 0.68
5 0.65
6 0.63
7 0.55
8 0.5
9 0.47
10 0.46
11 0.42
12 0.34
13 0.27
14 0.18
15 0.16
16 0.15
17 0.1
18 0.08
19 0.09
20 0.08
21 0.08
22 0.07
23 0.07
24 0.05
25 0.06
26 0.06
27 0.06
28 0.04
29 0.04
30 0.04
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.09
37 0.12
38 0.15
39 0.2
40 0.21
41 0.27
42 0.31
43 0.39
44 0.4
45 0.37
46 0.44
47 0.44
48 0.45
49 0.45
50 0.44
51 0.44
52 0.48
53 0.51
54 0.45
55 0.49
56 0.54
57 0.51
58 0.5
59 0.47
60 0.48
61 0.47
62 0.5
63 0.47
64 0.41
65 0.44