Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CRC0

Protein Details
Accession A0A0D0CRC0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94PVKGGPKTGKSCREKWKRVRBasic
NLS Segment(s)
PositionSequence
77-94KGGPKTGKSCREKWKRVR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MPPRRSSRSSPKGTSKAQDTSPSQAPTSAPVSWSLADVNVLIDEVIAQQAKAGDGLNFRPSVWTSISACPGLSKPVKGGPKTGKSCREKWKRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.67
3 0.61
4 0.56
5 0.55
6 0.48
7 0.46
8 0.47
9 0.43
10 0.37
11 0.34
12 0.3
13 0.26
14 0.27
15 0.21
16 0.16
17 0.15
18 0.16
19 0.15
20 0.16
21 0.12
22 0.09
23 0.09
24 0.08
25 0.07
26 0.05
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.03
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.07
42 0.09
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.14
49 0.14
50 0.16
51 0.17
52 0.19
53 0.22
54 0.21
55 0.2
56 0.19
57 0.18
58 0.21
59 0.2
60 0.18
61 0.19
62 0.26
63 0.33
64 0.33
65 0.41
66 0.43
67 0.51
68 0.59
69 0.65
70 0.68
71 0.67
72 0.75
73 0.78
74 0.79