Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D0H3

Protein Details
Accession A0A0D0D0H3   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-54LYMCKEKLCPHKDKKEPTRCAKCQRWGHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences APNQCVAHILLQLANPHSANKFMKDRLYMCKEKLCPHKDKKEPTRCAKCQRWGHIVVNCHAERDACTTCGEEHRLSKCTSKNTCYCISCENGSHSSNDCHCPTYKQECAILDMRHLENSMPYFPTNESWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.18
5 0.22
6 0.23
7 0.26
8 0.3
9 0.31
10 0.35
11 0.38
12 0.4
13 0.43
14 0.5
15 0.48
16 0.45
17 0.5
18 0.49
19 0.52
20 0.59
21 0.56
22 0.58
23 0.63
24 0.71
25 0.71
26 0.79
27 0.81
28 0.82
29 0.84
30 0.85
31 0.86
32 0.83
33 0.85
34 0.82
35 0.81
36 0.78
37 0.75
38 0.71
39 0.65
40 0.62
41 0.56
42 0.51
43 0.43
44 0.42
45 0.35
46 0.29
47 0.24
48 0.2
49 0.17
50 0.19
51 0.18
52 0.12
53 0.12
54 0.13
55 0.13
56 0.15
57 0.18
58 0.14
59 0.18
60 0.2
61 0.22
62 0.23
63 0.27
64 0.29
65 0.34
66 0.38
67 0.39
68 0.41
69 0.43
70 0.48
71 0.44
72 0.42
73 0.36
74 0.35
75 0.31
76 0.28
77 0.28
78 0.25
79 0.25
80 0.25
81 0.24
82 0.25
83 0.26
84 0.29
85 0.26
86 0.25
87 0.25
88 0.27
89 0.32
90 0.36
91 0.38
92 0.36
93 0.38
94 0.37
95 0.41
96 0.43
97 0.36
98 0.3
99 0.31
100 0.29
101 0.27
102 0.26
103 0.22
104 0.2
105 0.22
106 0.22
107 0.19
108 0.19
109 0.2
110 0.21