Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DEH3

Protein Details
Accession A0A0D0DEH3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-53CCVSKLLKYARKKRKLNLVDIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAASCCGHRALCRALLHALNAVIRFAAATVTACCVSKLLKYARKKRKLNLVDIVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.28
4 0.25
5 0.21
6 0.16
7 0.15
8 0.13
9 0.09
10 0.08
11 0.07
12 0.05
13 0.04
14 0.03
15 0.04
16 0.04
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.08
23 0.09
24 0.14
25 0.21
26 0.29
27 0.39
28 0.5
29 0.61
30 0.7
31 0.76
32 0.78
33 0.81
34 0.81
35 0.79
36 0.78