Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EBE0

Protein Details
Accession A0A0D0EBE0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-119DDGPGGKAEKRRLRKEHRQHLKDKNMFKTKBasic
NLS Segment(s)
PositionSequence
94-117GGKAEKRRLRKEHRQHLKDKNMFK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLPRTTFRRGFSFICARGYAATSSSKPAPYQPLKGASSTEPTKAVSSCPAGTALTGLNYLKGEPPILALPDEEYPSWLWDLTKPKALEDDGPGGKAEKRRLRKEHRQHLKDKNMFKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.41
4 0.35
5 0.31
6 0.31
7 0.24
8 0.17
9 0.19
10 0.16
11 0.19
12 0.21
13 0.21
14 0.2
15 0.23
16 0.3
17 0.31
18 0.35
19 0.36
20 0.4
21 0.39
22 0.39
23 0.38
24 0.3
25 0.32
26 0.29
27 0.25
28 0.2
29 0.2
30 0.2
31 0.19
32 0.18
33 0.15
34 0.16
35 0.14
36 0.14
37 0.13
38 0.12
39 0.12
40 0.11
41 0.09
42 0.06
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.08
58 0.09
59 0.1
60 0.09
61 0.09
62 0.09
63 0.1
64 0.1
65 0.09
66 0.08
67 0.12
68 0.19
69 0.2
70 0.26
71 0.26
72 0.26
73 0.29
74 0.29
75 0.27
76 0.25
77 0.29
78 0.23
79 0.24
80 0.24
81 0.22
82 0.24
83 0.27
84 0.33
85 0.35
86 0.44
87 0.53
88 0.63
89 0.72
90 0.8
91 0.86
92 0.88
93 0.9
94 0.89
95 0.89
96 0.9
97 0.9
98 0.88
99 0.85