Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EBT8

Protein Details
Accession A0A0D0EBT8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
30-55QATASRELKRRQRCRRYWHNNISPGIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGIERRIPYYTYKVAQESGWTVERGQCIQQATASRELKRRQRCRRYWHNNISPGIRRKPVIGHWHTRTVTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.25
5 0.23
6 0.22
7 0.19
8 0.18
9 0.19
10 0.2
11 0.19
12 0.18
13 0.17
14 0.16
15 0.16
16 0.17
17 0.18
18 0.19
19 0.26
20 0.28
21 0.28
22 0.32
23 0.38
24 0.45
25 0.51
26 0.59
27 0.62
28 0.7
29 0.76
30 0.8
31 0.86
32 0.87
33 0.88
34 0.88
35 0.86
36 0.82
37 0.77
38 0.73
39 0.7
40 0.68
41 0.63
42 0.56
43 0.48
44 0.43
45 0.45
46 0.46
47 0.49
48 0.48
49 0.52
50 0.54
51 0.62