Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DBC7

Protein Details
Accession A0A0D0DBC7   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-51QYCNKTYKPQGIKKHKASCKKHQQAVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Pfam View protein in Pfam  
PF13913  zf-C2HC_2  
Amino Acid Sequences MVPSHRTQVKYNYTDKTLYVQIQCQYCNKTYKPQGIKKHKASCKKHQQAVREQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.39
4 0.33
5 0.3
6 0.26
7 0.25
8 0.26
9 0.26
10 0.27
11 0.26
12 0.25
13 0.25
14 0.28
15 0.26
16 0.31
17 0.35
18 0.43
19 0.5
20 0.56
21 0.63
22 0.69
23 0.78
24 0.79
25 0.83
26 0.82
27 0.84
28 0.84
29 0.84
30 0.85
31 0.85
32 0.83
33 0.79