Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E3Q4

Protein Details
Accession A0A0D0E3Q4   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
52-87VEKDEVRRARKRERKERDKERKKKAPEKAPEKKPTVBasic
186-208ATSTPPPRKKRVAVKKGWKGWVEHydrophilic
NLS Segment(s)
PositionSequence
58-84RRARKRERKERDKERKKKAPEKAPEKK
192-204PRKKRVAVKKGWK
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
Amino Acid Sequences MFLVMSQHTTAFHNHKRHRRTATSVLAGDFDQRSARDVLTSLLNGVGPYKEVEKDEVRRARKRERKERDKERKKKAPEKAPEKKPTVESLSAAVSTPALPAPSLPSQSASAPPMQPSSFWRARGTSHRPTIHIATMQRSVSVTPPPMASSPRSTPGPSDWSTTSRTSSKRPRTPDDDADALEPAVATSTPPPRKKRVAVKKGWKGWVEGSPPPSEKLINLDAVPILQERRTRSGKSFDAIGVGKDSWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.68
4 0.76
5 0.79
6 0.77
7 0.77
8 0.76
9 0.76
10 0.73
11 0.66
12 0.58
13 0.5
14 0.43
15 0.38
16 0.28
17 0.21
18 0.16
19 0.14
20 0.16
21 0.16
22 0.16
23 0.14
24 0.14
25 0.15
26 0.15
27 0.15
28 0.13
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.08
35 0.09
36 0.1
37 0.12
38 0.13
39 0.17
40 0.22
41 0.27
42 0.36
43 0.43
44 0.48
45 0.54
46 0.6
47 0.66
48 0.69
49 0.75
50 0.77
51 0.8
52 0.83
53 0.87
54 0.92
55 0.92
56 0.95
57 0.94
58 0.94
59 0.92
60 0.91
61 0.9
62 0.89
63 0.87
64 0.86
65 0.87
66 0.87
67 0.87
68 0.85
69 0.8
70 0.73
71 0.65
72 0.6
73 0.54
74 0.45
75 0.36
76 0.29
77 0.25
78 0.22
79 0.19
80 0.14
81 0.09
82 0.08
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.09
89 0.1
90 0.12
91 0.11
92 0.13
93 0.14
94 0.15
95 0.16
96 0.14
97 0.14
98 0.13
99 0.14
100 0.14
101 0.13
102 0.13
103 0.14
104 0.21
105 0.21
106 0.22
107 0.23
108 0.22
109 0.25
110 0.32
111 0.37
112 0.36
113 0.4
114 0.4
115 0.4
116 0.42
117 0.41
118 0.35
119 0.31
120 0.25
121 0.21
122 0.23
123 0.21
124 0.19
125 0.17
126 0.16
127 0.14
128 0.15
129 0.13
130 0.11
131 0.11
132 0.12
133 0.13
134 0.15
135 0.15
136 0.17
137 0.19
138 0.22
139 0.23
140 0.22
141 0.23
142 0.24
143 0.28
144 0.24
145 0.26
146 0.24
147 0.24
148 0.28
149 0.27
150 0.27
151 0.27
152 0.28
153 0.33
154 0.42
155 0.5
156 0.54
157 0.6
158 0.64
159 0.66
160 0.71
161 0.69
162 0.63
163 0.55
164 0.49
165 0.43
166 0.36
167 0.28
168 0.2
169 0.13
170 0.08
171 0.06
172 0.05
173 0.05
174 0.08
175 0.18
176 0.26
177 0.34
178 0.39
179 0.46
180 0.54
181 0.62
182 0.69
183 0.72
184 0.74
185 0.77
186 0.83
187 0.86
188 0.86
189 0.85
190 0.76
191 0.67
192 0.61
193 0.57
194 0.51
195 0.46
196 0.41
197 0.39
198 0.39
199 0.37
200 0.35
201 0.28
202 0.24
203 0.25
204 0.25
205 0.22
206 0.2
207 0.2
208 0.18
209 0.17
210 0.18
211 0.14
212 0.13
213 0.14
214 0.18
215 0.22
216 0.3
217 0.35
218 0.38
219 0.42
220 0.49
221 0.49
222 0.48
223 0.47
224 0.39
225 0.4
226 0.36
227 0.32
228 0.27