Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HF27

Protein Details
Accession C6HF27    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-121ATKASAGSRRSRNRRGRNVGRPKPKSIHydrophilic
NLS Segment(s)
PositionSequence
89-119QPKPVSATKASAGSRRSRNRRGRNVGRPKPK
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MAWHLEYFHKSAGPVKKVMLTYNQNGTSRGIASITFVRPDTAAKAAKELNGLLIDKRPIKIEVVLDASRAPTVPAVKPLTERVAQPKPQPKPVSATKASAGSRRSRNRRGRNVGRPKPKSIAELDAEMEDYFPSSNTAPAATNGAAQPAAAGGEDLGMDEIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.36
4 0.37
5 0.38
6 0.39
7 0.37
8 0.37
9 0.43
10 0.46
11 0.42
12 0.42
13 0.41
14 0.34
15 0.29
16 0.25
17 0.17
18 0.12
19 0.14
20 0.17
21 0.16
22 0.16
23 0.15
24 0.15
25 0.15
26 0.16
27 0.16
28 0.17
29 0.2
30 0.18
31 0.21
32 0.22
33 0.23
34 0.23
35 0.2
36 0.16
37 0.14
38 0.15
39 0.12
40 0.14
41 0.16
42 0.16
43 0.17
44 0.17
45 0.16
46 0.17
47 0.18
48 0.17
49 0.16
50 0.19
51 0.19
52 0.17
53 0.16
54 0.16
55 0.13
56 0.12
57 0.1
58 0.06
59 0.08
60 0.09
61 0.14
62 0.15
63 0.15
64 0.16
65 0.18
66 0.2
67 0.19
68 0.19
69 0.21
70 0.25
71 0.28
72 0.33
73 0.39
74 0.39
75 0.46
76 0.47
77 0.42
78 0.42
79 0.45
80 0.47
81 0.41
82 0.4
83 0.33
84 0.36
85 0.36
86 0.35
87 0.31
88 0.3
89 0.38
90 0.45
91 0.52
92 0.57
93 0.67
94 0.73
95 0.81
96 0.85
97 0.86
98 0.87
99 0.9
100 0.89
101 0.9
102 0.84
103 0.79
104 0.74
105 0.66
106 0.58
107 0.51
108 0.46
109 0.38
110 0.34
111 0.3
112 0.25
113 0.24
114 0.2
115 0.16
116 0.1
117 0.09
118 0.07
119 0.06
120 0.08
121 0.07
122 0.09
123 0.09
124 0.1
125 0.11
126 0.12
127 0.15
128 0.14
129 0.15
130 0.14
131 0.15
132 0.14
133 0.13
134 0.12
135 0.08
136 0.08
137 0.06
138 0.06
139 0.04
140 0.05
141 0.05
142 0.05