Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DCF0

Protein Details
Accession A0A0D0DCF0   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
116-142SELGSSFRRENRKRKRPQSPVGSPQPYHydrophilic
NLS Segment(s)
PositionSequence
124-131RENRKRKR
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021627  Mediator_Med27  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11571  Med27  
Amino Acid Sequences MASPVTDTTPKAPNEPATTAPPPSLQDRIQTLTDVHNRLQALRHMPSMLLKPPSASLLSDFSPPFDPTVDQDFIAAFNSTPARDLHTLKEFSEVLCSEKVQEALRAARASEEADQSELGSSFRRENRKRKRPQSPVGSPQPYIPPPPRSSSLFSPIEDDPPPLRAESLFEFLREFNRGNLVEFKRPVPSELDGPSPPRCRLAIWLRTKTLRDELGVASSSAPTSVSSKPRGGKLTSPAVIRFVIPDVLTAYVSLIFTSLDSPLVVESVTAFGPRERKLPHEQSDYLALQVLSQHLAKTIQSHPRVPLQILINLLVSYRGLFVDRCTSCERVLSAEGHIPPVGRVWVAKEQLPPSNTSGKTSDADIDTPGGPADPAPGSSGHTEPASGHWEPRHVTCLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.41
4 0.41
5 0.43
6 0.41
7 0.38
8 0.35
9 0.31
10 0.32
11 0.34
12 0.28
13 0.3
14 0.33
15 0.36
16 0.34
17 0.33
18 0.31
19 0.34
20 0.4
21 0.38
22 0.34
23 0.35
24 0.34
25 0.34
26 0.37
27 0.35
28 0.34
29 0.33
30 0.34
31 0.3
32 0.31
33 0.33
34 0.33
35 0.33
36 0.3
37 0.27
38 0.26
39 0.26
40 0.28
41 0.25
42 0.21
43 0.18
44 0.17
45 0.19
46 0.22
47 0.21
48 0.2
49 0.22
50 0.22
51 0.2
52 0.18
53 0.18
54 0.17
55 0.24
56 0.23
57 0.2
58 0.19
59 0.18
60 0.17
61 0.18
62 0.15
63 0.08
64 0.1
65 0.11
66 0.11
67 0.12
68 0.12
69 0.16
70 0.19
71 0.22
72 0.25
73 0.31
74 0.32
75 0.31
76 0.35
77 0.3
78 0.26
79 0.29
80 0.24
81 0.19
82 0.19
83 0.19
84 0.16
85 0.18
86 0.19
87 0.15
88 0.17
89 0.17
90 0.19
91 0.22
92 0.21
93 0.19
94 0.18
95 0.18
96 0.17
97 0.17
98 0.17
99 0.14
100 0.14
101 0.14
102 0.13
103 0.13
104 0.12
105 0.09
106 0.09
107 0.1
108 0.15
109 0.21
110 0.31
111 0.39
112 0.5
113 0.61
114 0.7
115 0.79
116 0.84
117 0.89
118 0.89
119 0.9
120 0.9
121 0.87
122 0.86
123 0.85
124 0.77
125 0.67
126 0.59
127 0.55
128 0.45
129 0.41
130 0.38
131 0.34
132 0.34
133 0.37
134 0.38
135 0.36
136 0.4
137 0.38
138 0.4
139 0.36
140 0.34
141 0.33
142 0.3
143 0.3
144 0.26
145 0.24
146 0.17
147 0.17
148 0.17
149 0.13
150 0.13
151 0.1
152 0.12
153 0.12
154 0.15
155 0.14
156 0.13
157 0.14
158 0.14
159 0.16
160 0.16
161 0.14
162 0.1
163 0.15
164 0.15
165 0.15
166 0.23
167 0.24
168 0.27
169 0.27
170 0.28
171 0.27
172 0.27
173 0.27
174 0.21
175 0.2
176 0.19
177 0.19
178 0.21
179 0.18
180 0.21
181 0.25
182 0.25
183 0.24
184 0.22
185 0.21
186 0.18
187 0.24
188 0.3
189 0.34
190 0.39
191 0.43
192 0.43
193 0.45
194 0.46
195 0.41
196 0.36
197 0.28
198 0.21
199 0.19
200 0.17
201 0.17
202 0.16
203 0.14
204 0.11
205 0.1
206 0.09
207 0.07
208 0.06
209 0.05
210 0.08
211 0.12
212 0.16
213 0.19
214 0.24
215 0.26
216 0.3
217 0.33
218 0.32
219 0.32
220 0.33
221 0.36
222 0.35
223 0.34
224 0.3
225 0.29
226 0.27
227 0.23
228 0.19
229 0.13
230 0.11
231 0.09
232 0.09
233 0.08
234 0.09
235 0.08
236 0.08
237 0.07
238 0.07
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.06
245 0.06
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.05
252 0.04
253 0.04
254 0.05
255 0.05
256 0.06
257 0.06
258 0.08
259 0.13
260 0.14
261 0.19
262 0.19
263 0.25
264 0.34
265 0.42
266 0.47
267 0.5
268 0.5
269 0.47
270 0.51
271 0.46
272 0.36
273 0.29
274 0.22
275 0.15
276 0.15
277 0.14
278 0.1
279 0.1
280 0.1
281 0.09
282 0.1
283 0.1
284 0.14
285 0.2
286 0.27
287 0.31
288 0.33
289 0.35
290 0.41
291 0.43
292 0.39
293 0.38
294 0.32
295 0.3
296 0.29
297 0.27
298 0.21
299 0.18
300 0.18
301 0.12
302 0.1
303 0.08
304 0.07
305 0.07
306 0.07
307 0.08
308 0.1
309 0.19
310 0.19
311 0.23
312 0.26
313 0.28
314 0.27
315 0.3
316 0.29
317 0.23
318 0.26
319 0.23
320 0.21
321 0.25
322 0.25
323 0.24
324 0.24
325 0.2
326 0.18
327 0.18
328 0.17
329 0.11
330 0.11
331 0.15
332 0.22
333 0.24
334 0.27
335 0.31
336 0.34
337 0.4
338 0.41
339 0.39
340 0.36
341 0.43
342 0.4
343 0.38
344 0.36
345 0.33
346 0.33
347 0.32
348 0.32
349 0.25
350 0.25
351 0.23
352 0.23
353 0.2
354 0.19
355 0.17
356 0.12
357 0.1
358 0.09
359 0.11
360 0.1
361 0.1
362 0.11
363 0.12
364 0.14
365 0.17
366 0.18
367 0.17
368 0.17
369 0.17
370 0.16
371 0.19
372 0.22
373 0.2
374 0.24
375 0.25
376 0.29
377 0.31
378 0.34
379 0.35