Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DVR1

Protein Details
Accession A0A0D0DVR1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-80VGIHLQQQKQKQKQKQKRMETNQIAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MEGHHVLIPRRGLAMLASCLTDRGVRSQVHLDAAPVRRRRHMYINTTATLQELLVGIHLQQQKQKQKQKQKRMETNQIAGMMMRLMYRWNMYTIKGSLEHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.14
4 0.15
5 0.13
6 0.14
7 0.14
8 0.15
9 0.12
10 0.14
11 0.18
12 0.18
13 0.21
14 0.24
15 0.24
16 0.25
17 0.24
18 0.21
19 0.22
20 0.27
21 0.32
22 0.34
23 0.35
24 0.38
25 0.42
26 0.45
27 0.48
28 0.5
29 0.49
30 0.52
31 0.54
32 0.49
33 0.46
34 0.42
35 0.33
36 0.25
37 0.18
38 0.1
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.1
45 0.12
46 0.12
47 0.16
48 0.24
49 0.33
50 0.43
51 0.52
52 0.56
53 0.66
54 0.76
55 0.83
56 0.86
57 0.88
58 0.89
59 0.89
60 0.91
61 0.86
62 0.79
63 0.71
64 0.61
65 0.51
66 0.39
67 0.3
68 0.2
69 0.13
70 0.1
71 0.06
72 0.07
73 0.08
74 0.11
75 0.12
76 0.15
77 0.17
78 0.18
79 0.24
80 0.23
81 0.25