Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CA91

Protein Details
Accession A0A0D0CA91   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-87LIGSGSRKKKQHVKKKEKRIATNSYPSTHydrophilic
NLS Segment(s)
PositionSequence
62-78GSGSRKKKQHVKKKEKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIPTQNPHNTIPPDYGADRFAPAWQPLVASFGISHEEAAQQLLEIWTANRNEFLDSEKKLIGSGSRKKKQHVKKKEKRIATNSYPSTTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.24
4 0.22
5 0.21
6 0.18
7 0.18
8 0.17
9 0.16
10 0.16
11 0.15
12 0.14
13 0.13
14 0.14
15 0.13
16 0.1
17 0.09
18 0.08
19 0.1
20 0.09
21 0.09
22 0.07
23 0.08
24 0.07
25 0.08
26 0.07
27 0.04
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.1
39 0.11
40 0.14
41 0.15
42 0.16
43 0.18
44 0.18
45 0.17
46 0.17
47 0.17
48 0.18
49 0.22
50 0.3
51 0.39
52 0.47
53 0.5
54 0.57
55 0.66
56 0.72
57 0.75
58 0.77
59 0.78
60 0.8
61 0.89
62 0.92
63 0.91
64 0.91
65 0.88
66 0.86
67 0.83
68 0.83
69 0.76
70 0.7