Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6H7D7

Protein Details
Accession C6H7D7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
2-26APKSAKKESSTKKYTPQQASNPNSNHydrophilic
217-255QPPRQNANPKSKPTPKPKPKSKSKSKSKSPRQRAPLVVGHydrophilic
NLS Segment(s)
PositionSequence
224-249NPKSKPTPKPKPKSKSKSKSKSPRQR
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045054  P4HA-like  
IPR006620  Pro_4_hyd_alph  
IPR044862  Pro_4_hyd_alph_FE2OG_OXY  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF13640  2OG-FeII_Oxy_3  
Amino Acid Sequences MAPKSAKKESSTKKYTPQQASNPNSNHSNNNNSSNNPPNWPDLKPLVPASDLHLETLLDDQILIIRNLFTATLCKTYVSFLSTLPLVTTPGRPKKDEAVRVNDRFQVHDSAFAERLWSCTALKGLVLGEGGGDGAGGLPWGGEVLGLNPNIRIYRYGPGQFFDKHYDDSVPLTILPTIAAKTTWTLLIYLTTCAGGETVFYPETEEEEEGEEAEHAQPPRQNANPKSKPTPKPKPKSKSKSKSKSPRQRAPLVVGLETGMALLHRHGERCLLHEGREVVGGEKWVIRSDLVVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.79
4 0.78
5 0.77
6 0.79
7 0.8
8 0.8
9 0.73
10 0.68
11 0.65
12 0.59
13 0.56
14 0.51
15 0.53
16 0.49
17 0.54
18 0.53
19 0.49
20 0.53
21 0.54
22 0.51
23 0.47
24 0.44
25 0.43
26 0.43
27 0.42
28 0.41
29 0.37
30 0.37
31 0.36
32 0.36
33 0.31
34 0.28
35 0.27
36 0.26
37 0.28
38 0.26
39 0.23
40 0.21
41 0.19
42 0.18
43 0.19
44 0.14
45 0.07
46 0.07
47 0.06
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.07
57 0.08
58 0.11
59 0.13
60 0.13
61 0.14
62 0.14
63 0.15
64 0.16
65 0.15
66 0.14
67 0.11
68 0.13
69 0.12
70 0.12
71 0.11
72 0.1
73 0.1
74 0.1
75 0.15
76 0.22
77 0.3
78 0.33
79 0.35
80 0.37
81 0.44
82 0.51
83 0.56
84 0.53
85 0.54
86 0.59
87 0.61
88 0.61
89 0.56
90 0.48
91 0.41
92 0.37
93 0.32
94 0.24
95 0.25
96 0.23
97 0.21
98 0.22
99 0.2
100 0.19
101 0.14
102 0.16
103 0.12
104 0.12
105 0.1
106 0.1
107 0.11
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.06
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.03
132 0.06
133 0.06
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.09
140 0.09
141 0.12
142 0.16
143 0.19
144 0.19
145 0.2
146 0.23
147 0.22
148 0.23
149 0.25
150 0.23
151 0.2
152 0.21
153 0.2
154 0.18
155 0.18
156 0.16
157 0.11
158 0.09
159 0.09
160 0.08
161 0.07
162 0.06
163 0.06
164 0.06
165 0.05
166 0.06
167 0.05
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.09
175 0.09
176 0.09
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.05
183 0.05
184 0.05
185 0.07
186 0.07
187 0.07
188 0.09
189 0.09
190 0.1
191 0.12
192 0.11
193 0.09
194 0.11
195 0.11
196 0.1
197 0.1
198 0.08
199 0.08
200 0.08
201 0.11
202 0.1
203 0.12
204 0.14
205 0.17
206 0.23
207 0.28
208 0.36
209 0.4
210 0.51
211 0.56
212 0.61
213 0.67
214 0.72
215 0.75
216 0.77
217 0.82
218 0.82
219 0.84
220 0.89
221 0.9
222 0.91
223 0.93
224 0.93
225 0.93
226 0.93
227 0.93
228 0.93
229 0.94
230 0.94
231 0.95
232 0.94
233 0.93
234 0.9
235 0.88
236 0.82
237 0.77
238 0.72
239 0.63
240 0.53
241 0.43
242 0.35
243 0.26
244 0.21
245 0.15
246 0.08
247 0.05
248 0.05
249 0.05
250 0.11
251 0.12
252 0.14
253 0.15
254 0.2
255 0.21
256 0.25
257 0.33
258 0.29
259 0.29
260 0.33
261 0.34
262 0.3
263 0.32
264 0.29
265 0.22
266 0.22
267 0.21
268 0.17
269 0.18
270 0.18
271 0.17
272 0.17
273 0.15
274 0.16