Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D7N9

Protein Details
Accession A0A0D0D7N9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-105DPQPPKEQSECKKKGKKSKKKKNVHIITFSCTHydrophilic
NLS Segment(s)
PositionSequence
85-95KKKGKKSKKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 15, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MGSKKQHYKSKELIDSDTDDMEIETIVSLSSLSPSPPDNVSNASIIAVGCTPTPILTRNSIDHELDDSDVVLVDPQPPKEQSECKKKGKKSKKKKNVHIITFSCTNGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.47
4 0.39
5 0.28
6 0.21
7 0.17
8 0.14
9 0.1
10 0.06
11 0.04
12 0.04
13 0.04
14 0.03
15 0.04
16 0.03
17 0.05
18 0.05
19 0.05
20 0.07
21 0.08
22 0.1
23 0.11
24 0.12
25 0.12
26 0.14
27 0.16
28 0.15
29 0.14
30 0.12
31 0.11
32 0.1
33 0.09
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.07
42 0.09
43 0.11
44 0.13
45 0.15
46 0.19
47 0.21
48 0.2
49 0.19
50 0.19
51 0.16
52 0.15
53 0.13
54 0.09
55 0.07
56 0.06
57 0.06
58 0.05
59 0.04
60 0.08
61 0.1
62 0.11
63 0.14
64 0.15
65 0.18
66 0.22
67 0.31
68 0.36
69 0.46
70 0.53
71 0.61
72 0.69
73 0.75
74 0.82
75 0.85
76 0.87
77 0.87
78 0.9
79 0.91
80 0.93
81 0.95
82 0.95
83 0.95
84 0.92
85 0.91
86 0.83
87 0.78
88 0.71