Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E6F7

Protein Details
Accession A0A0D0E6F7   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-81TRGYDKRSATRKHQRKRGRNGERRHYRSYQBasic
NLS Segment(s)
PositionSequence
57-75KRSATRKHQRKRGRNGERR
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MCETTVSKQPIFASVLRSTRLYRTSRGLTSVPISLTLQRSTGKWKVENLQSTRGYDKRSATRKHQRKRGRNGERRHYRSYQLDQALAFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.29
4 0.31
5 0.29
6 0.31
7 0.36
8 0.33
9 0.31
10 0.35
11 0.38
12 0.37
13 0.39
14 0.35
15 0.3
16 0.29
17 0.27
18 0.21
19 0.17
20 0.17
21 0.16
22 0.17
23 0.15
24 0.15
25 0.14
26 0.15
27 0.19
28 0.23
29 0.23
30 0.23
31 0.24
32 0.28
33 0.33
34 0.39
35 0.36
36 0.39
37 0.37
38 0.38
39 0.4
40 0.37
41 0.34
42 0.31
43 0.33
44 0.35
45 0.42
46 0.45
47 0.51
48 0.6
49 0.68
50 0.74
51 0.79
52 0.82
53 0.83
54 0.89
55 0.9
56 0.91
57 0.9
58 0.9
59 0.91
60 0.91
61 0.88
62 0.84
63 0.77
64 0.73
65 0.72
66 0.7
67 0.68
68 0.61
69 0.56