Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DXE3

Protein Details
Accession A0A0D0DXE3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25DHGLTTKQTSRKKKDKFYITIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences APPDHGLTTKQTSRKKKDKFYITIGFACNANGSEKLEPFFVGKAKKQGLEECGFFYHHNKKAWMTADLFDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.83
5 0.84
6 0.81
7 0.79
8 0.76
9 0.7
10 0.64
11 0.55
12 0.46
13 0.36
14 0.3
15 0.22
16 0.15
17 0.12
18 0.09
19 0.1
20 0.1
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.11
27 0.12
28 0.14
29 0.15
30 0.21
31 0.23
32 0.25
33 0.27
34 0.29
35 0.31
36 0.32
37 0.31
38 0.27
39 0.26
40 0.25
41 0.24
42 0.27
43 0.3
44 0.33
45 0.36
46 0.36
47 0.37
48 0.42
49 0.45
50 0.43
51 0.37