Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EBS7

Protein Details
Accession A0A0D0EBS7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26YSKGRVLGHKRAKRNSSPNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.833, cyto 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRAKRNSSPNTSLIQIEGVATKEDAQFYLGKRVAYVYKASREIQGSKIRVIWGRVTRPHGNSGVVKSKFSSNLPPRAFGATVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.75
5 0.77
6 0.77
7 0.8
8 0.79
9 0.78
10 0.74
11 0.69
12 0.62
13 0.56
14 0.46
15 0.37
16 0.28
17 0.18
18 0.13
19 0.11
20 0.09
21 0.08
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.18
37 0.2
38 0.16
39 0.17
40 0.2
41 0.21
42 0.22
43 0.23
44 0.23
45 0.26
46 0.3
47 0.28
48 0.26
49 0.27
50 0.27
51 0.26
52 0.26
53 0.27
54 0.25
55 0.29
56 0.33
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.34
67 0.33
68 0.3
69 0.32
70 0.32
71 0.31
72 0.37
73 0.35
74 0.44
75 0.45
76 0.46
77 0.44
78 0.45
79 0.43
80 0.33
81 0.32
82 0.25
83 0.26
84 0.24
85 0.23
86 0.2