Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DT49

Protein Details
Accession A0A0D0DT49    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-44SAQAKRRAPTGKRRDGPKKKKANRACAHCQKAHydrophilic
NLS Segment(s)
PositionSequence
16-35AKRRAPTGKRRDGPKKKKAN
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MEQEQQAGPSSLSAQAKRRAPTGKRRDGPKKKKANRACAHCQKAHLTCDDSRPCQRCIKRGIAGSCVEGHRKKAKYLLDDDELEQLKRKSSIPKKSAEPQLVPIPCNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.4
4 0.41
5 0.46
6 0.49
7 0.52
8 0.59
9 0.64
10 0.67
11 0.68
12 0.76
13 0.81
14 0.84
15 0.87
16 0.87
17 0.87
18 0.85
19 0.9
20 0.89
21 0.89
22 0.86
23 0.84
24 0.84
25 0.83
26 0.8
27 0.71
28 0.64
29 0.59
30 0.54
31 0.47
32 0.39
33 0.32
34 0.28
35 0.33
36 0.34
37 0.32
38 0.35
39 0.36
40 0.36
41 0.4
42 0.41
43 0.39
44 0.42
45 0.44
46 0.42
47 0.45
48 0.44
49 0.4
50 0.38
51 0.34
52 0.31
53 0.26
54 0.26
55 0.22
56 0.25
57 0.29
58 0.3
59 0.31
60 0.34
61 0.38
62 0.38
63 0.43
64 0.43
65 0.39
66 0.39
67 0.39
68 0.38
69 0.34
70 0.29
71 0.28
72 0.23
73 0.21
74 0.22
75 0.24
76 0.29
77 0.37
78 0.48
79 0.49
80 0.55
81 0.6
82 0.67
83 0.73
84 0.7
85 0.63
86 0.58
87 0.62
88 0.58