Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DR75

Protein Details
Accession A0A0D0DR75    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
30-57PVMSWTPRRDRGRRRGHRRSRSHAAKPGBasic
NLS Segment(s)
PositionSequence
36-74PRRDRGRRRGHRRSRSHAAKPGGAPRAPHDPRLGREKRA
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MTGHRGAHMWRPADIAHVAPAADRRSALAPVMSWTPRRDRGRRRGHRRSRSHAAKPGGAPRAPHDPRLGREKRAGGSECGVQGSRRHWPRRSTLAVFENSGVRADTAGCIAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.21
3 0.16
4 0.15
5 0.14
6 0.13
7 0.17
8 0.15
9 0.15
10 0.14
11 0.14
12 0.15
13 0.16
14 0.15
15 0.12
16 0.11
17 0.12
18 0.16
19 0.16
20 0.17
21 0.19
22 0.24
23 0.32
24 0.39
25 0.47
26 0.53
27 0.62
28 0.71
29 0.79
30 0.84
31 0.87
32 0.9
33 0.91
34 0.9
35 0.88
36 0.87
37 0.84
38 0.8
39 0.77
40 0.69
41 0.61
42 0.55
43 0.52
44 0.45
45 0.37
46 0.31
47 0.26
48 0.33
49 0.31
50 0.31
51 0.3
52 0.3
53 0.32
54 0.42
55 0.42
56 0.35
57 0.39
58 0.41
59 0.38
60 0.4
61 0.39
62 0.31
63 0.3
64 0.28
65 0.24
66 0.22
67 0.2
68 0.16
69 0.17
70 0.18
71 0.25
72 0.32
73 0.39
74 0.44
75 0.49
76 0.56
77 0.62
78 0.67
79 0.62
80 0.61
81 0.6
82 0.56
83 0.52
84 0.45
85 0.38
86 0.31
87 0.28
88 0.2
89 0.14
90 0.12
91 0.11
92 0.1
93 0.09