Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DWZ1

Protein Details
Accession A0A0D0DWZ1   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-105YVPKPIKRPPFKSRHQHRTNTMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR004367  Cyclin_C-dom  
Pfam View protein in Pfam  
PF02984  Cyclin_C  
Amino Acid Sequences MHFLRRISKADDYELKACTIGKYLLEVGTLEWRLLATPPLSMAAAVIWLARLILGNDTWTATLAHYPSYVESPSIPITNPIPNYVPKPIKRPPFKSRHQHRTNTMGPMAMTMPTAPSAPLPPLPPLPILVQPSPEKNVSLSSEDQAATARIWAKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.33
4 0.31
5 0.25
6 0.21
7 0.16
8 0.14
9 0.15
10 0.16
11 0.15
12 0.15
13 0.14
14 0.12
15 0.16
16 0.16
17 0.14
18 0.12
19 0.12
20 0.12
21 0.12
22 0.13
23 0.08
24 0.08
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.06
31 0.05
32 0.05
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.09
57 0.07
58 0.07
59 0.09
60 0.1
61 0.1
62 0.09
63 0.09
64 0.11
65 0.13
66 0.14
67 0.13
68 0.14
69 0.15
70 0.17
71 0.22
72 0.27
73 0.26
74 0.33
75 0.38
76 0.46
77 0.53
78 0.59
79 0.62
80 0.64
81 0.71
82 0.76
83 0.8
84 0.81
85 0.81
86 0.8
87 0.76
88 0.75
89 0.7
90 0.63
91 0.53
92 0.43
93 0.34
94 0.28
95 0.24
96 0.16
97 0.12
98 0.07
99 0.08
100 0.07
101 0.07
102 0.06
103 0.07
104 0.08
105 0.1
106 0.12
107 0.13
108 0.15
109 0.17
110 0.18
111 0.18
112 0.19
113 0.19
114 0.22
115 0.25
116 0.23
117 0.26
118 0.27
119 0.3
120 0.32
121 0.3
122 0.27
123 0.23
124 0.26
125 0.25
126 0.27
127 0.25
128 0.23
129 0.25
130 0.24
131 0.24
132 0.21
133 0.19
134 0.14
135 0.15
136 0.19