Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DJI9

Protein Details
Accession A0A0D0DJI9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
41-60RLWQCKCRCHEKHNHMHHCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 12.333, nucl 4, cyto_nucl 3.333
Family & Domain DBs
Amino Acid Sequences RHAMPVIQRPARRAWDDKHDTNCKRINKVIHTRNGGVTLCRLWQCKCRCHEKHNHMHHCSGCGAITHGASRCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.56
4 0.59
5 0.62
6 0.65
7 0.62
8 0.63
9 0.65
10 0.59
11 0.56
12 0.55
13 0.52
14 0.51
15 0.59
16 0.6
17 0.6
18 0.59
19 0.55
20 0.51
21 0.47
22 0.38
23 0.28
24 0.22
25 0.16
26 0.14
27 0.15
28 0.16
29 0.15
30 0.23
31 0.28
32 0.34
33 0.38
34 0.47
35 0.5
36 0.57
37 0.67
38 0.69
39 0.74
40 0.78
41 0.83
42 0.76
43 0.76
44 0.69
45 0.61
46 0.51
47 0.41
48 0.31
49 0.22
50 0.21
51 0.17
52 0.16
53 0.17