Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E205

Protein Details
Accession A0A0D0E205   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
199-221IEEQRARSRARSKSRGRRVSFKLHydrophilic
NLS Segment(s)
PositionSequence
204-216ARSRARSKSRGRR
254-288KGRGRGKGKILEVPKNPSRLENRGSPPRRDIPRGR
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSRSSVKSSQVIDLSRPLEKDLSPPGQLASAPSRSSSFSSASTPLQHSALPAPTYRPHGHGSIPPSHDYDYNMTPLPHLHQQRHLSHPSPIHPPANRAPGPLLPGHPPPPIDSMQTQQAHYLLAQAMHQLSYLMSATMPSYGPYTSSPGQPWQYPPSAYGTPANASSHNARAYHAPSSSLPHSALPPSSPLQPSVSPPIEEQRARSRARSKSRGRRVSFKLDNEVGSDTQDGDIDVPRQDGEQRLHKQAQESVKGRGRGKGKILEVPKNPSRLENRGSPPRRDIPRGRTPGPPCRDECHAPRGRSVSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.33
4 0.3
5 0.28
6 0.26
7 0.28
8 0.3
9 0.32
10 0.3
11 0.3
12 0.28
13 0.27
14 0.27
15 0.26
16 0.24
17 0.23
18 0.22
19 0.23
20 0.24
21 0.25
22 0.27
23 0.26
24 0.23
25 0.21
26 0.23
27 0.25
28 0.26
29 0.28
30 0.28
31 0.26
32 0.25
33 0.23
34 0.22
35 0.22
36 0.24
37 0.21
38 0.2
39 0.22
40 0.24
41 0.31
42 0.31
43 0.31
44 0.3
45 0.3
46 0.32
47 0.33
48 0.35
49 0.36
50 0.37
51 0.36
52 0.35
53 0.35
54 0.32
55 0.3
56 0.29
57 0.23
58 0.23
59 0.23
60 0.2
61 0.19
62 0.19
63 0.2
64 0.24
65 0.27
66 0.28
67 0.34
68 0.42
69 0.46
70 0.52
71 0.53
72 0.48
73 0.47
74 0.48
75 0.44
76 0.43
77 0.42
78 0.41
79 0.37
80 0.4
81 0.41
82 0.46
83 0.43
84 0.37
85 0.35
86 0.31
87 0.32
88 0.28
89 0.25
90 0.19
91 0.22
92 0.23
93 0.22
94 0.21
95 0.21
96 0.23
97 0.22
98 0.22
99 0.2
100 0.19
101 0.26
102 0.27
103 0.25
104 0.22
105 0.21
106 0.19
107 0.17
108 0.17
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.06
117 0.05
118 0.06
119 0.06
120 0.05
121 0.04
122 0.05
123 0.05
124 0.06
125 0.06
126 0.05
127 0.06
128 0.06
129 0.07
130 0.08
131 0.12
132 0.12
133 0.14
134 0.15
135 0.17
136 0.19
137 0.19
138 0.22
139 0.21
140 0.21
141 0.2
142 0.19
143 0.21
144 0.2
145 0.19
146 0.18
147 0.15
148 0.14
149 0.15
150 0.15
151 0.11
152 0.13
153 0.14
154 0.15
155 0.16
156 0.16
157 0.15
158 0.17
159 0.19
160 0.19
161 0.17
162 0.16
163 0.15
164 0.18
165 0.19
166 0.18
167 0.17
168 0.15
169 0.16
170 0.15
171 0.15
172 0.11
173 0.13
174 0.13
175 0.16
176 0.16
177 0.16
178 0.18
179 0.18
180 0.2
181 0.24
182 0.24
183 0.22
184 0.22
185 0.25
186 0.27
187 0.27
188 0.28
189 0.3
190 0.36
191 0.37
192 0.42
193 0.45
194 0.49
195 0.59
196 0.65
197 0.67
198 0.71
199 0.8
200 0.84
201 0.81
202 0.81
203 0.78
204 0.78
205 0.75
206 0.68
207 0.64
208 0.56
209 0.52
210 0.44
211 0.4
212 0.3
213 0.24
214 0.2
215 0.14
216 0.12
217 0.11
218 0.09
219 0.08
220 0.09
221 0.09
222 0.09
223 0.1
224 0.09
225 0.1
226 0.12
227 0.16
228 0.19
229 0.28
230 0.32
231 0.39
232 0.42
233 0.43
234 0.44
235 0.46
236 0.49
237 0.48
238 0.46
239 0.47
240 0.5
241 0.55
242 0.53
243 0.53
244 0.5
245 0.47
246 0.51
247 0.5
248 0.47
249 0.48
250 0.53
251 0.56
252 0.56
253 0.59
254 0.58
255 0.55
256 0.53
257 0.52
258 0.52
259 0.5
260 0.5
261 0.51
262 0.54
263 0.6
264 0.65
265 0.64
266 0.65
267 0.67
268 0.7
269 0.69
270 0.7
271 0.68
272 0.73
273 0.76
274 0.71
275 0.71
276 0.72
277 0.73
278 0.7
279 0.68
280 0.61
281 0.58
282 0.62
283 0.6
284 0.58
285 0.59
286 0.61
287 0.56
288 0.59
289 0.62