Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E9J1

Protein Details
Accession A0A0D0E9J1   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-37RWNVENKQAKSERRKPRWSKPKFKKLESPFPRHydrophilic
NLS Segment(s)
PositionSequence
14-31AKSERRKPRWSKPKFKKL
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences REEIVRWNVENKQAKSERRKPRWSKPKFKKLESPFPRPSIDTQETEGQPDANIEAGETDDRSSNNKSDGGSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.72
4 0.74
5 0.74
6 0.83
7 0.82
8 0.86
9 0.89
10 0.89
11 0.9
12 0.9
13 0.91
14 0.87
15 0.84
16 0.83
17 0.8
18 0.8
19 0.76
20 0.74
21 0.68
22 0.63
23 0.59
24 0.5
25 0.44
26 0.41
27 0.38
28 0.3
29 0.28
30 0.3
31 0.29
32 0.3
33 0.28
34 0.19
35 0.16
36 0.15
37 0.12
38 0.08
39 0.07
40 0.05
41 0.05
42 0.06
43 0.07
44 0.07
45 0.08
46 0.09
47 0.1
48 0.14
49 0.17
50 0.19
51 0.21
52 0.23
53 0.23