Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E696

Protein Details
Accession A0A0D0E696   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-79GVRGRGYEQRKRKQLRRLSVVKKQRVIGHydrophilic
NLS Segment(s)
PositionSequence
61-70RKRKQLRRLS
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAWGTKMILERGRPCHTSDLSGLLAKPLTKQSGDPLIREVLRPQALEMSLDGVRGRGYEQRKRKQLRRLSVVKKQRVIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.42
4 0.39
5 0.34
6 0.31
7 0.27
8 0.26
9 0.24
10 0.17
11 0.17
12 0.14
13 0.14
14 0.13
15 0.13
16 0.13
17 0.13
18 0.16
19 0.25
20 0.26
21 0.24
22 0.24
23 0.24
24 0.24
25 0.24
26 0.21
27 0.16
28 0.16
29 0.16
30 0.14
31 0.13
32 0.13
33 0.13
34 0.13
35 0.11
36 0.09
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.09
43 0.13
44 0.2
45 0.29
46 0.39
47 0.49
48 0.59
49 0.69
50 0.75
51 0.79
52 0.82
53 0.83
54 0.83
55 0.84
56 0.83
57 0.84
58 0.86
59 0.85