Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E605

Protein Details
Accession A0A0D0E605   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-82KSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
46-73AGKVKSQTPKVEKQEKKKTPKGRAKKRM
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGGRQLPMNLNVGTIQDQFRLHTVTTIGETPNLDNMGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNVTTLPGGKRRMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.16
5 0.17
6 0.18
7 0.19
8 0.16
9 0.15
10 0.15
11 0.13
12 0.14
13 0.15
14 0.13
15 0.12
16 0.13
17 0.12
18 0.13
19 0.14
20 0.12
21 0.1
22 0.1
23 0.12
24 0.11
25 0.11
26 0.09
27 0.09
28 0.1
29 0.13
30 0.14
31 0.14
32 0.16
33 0.16
34 0.19
35 0.2
36 0.24
37 0.26
38 0.31
39 0.34
40 0.38
41 0.46
42 0.51
43 0.59
44 0.61
45 0.66
46 0.72
47 0.74
48 0.78
49 0.79
50 0.81
51 0.81
52 0.85
53 0.86
54 0.86
55 0.88
56 0.89
57 0.89
58 0.9
59 0.9
60 0.9
61 0.87
62 0.85
63 0.83
64 0.77
65 0.69
66 0.59
67 0.56
68 0.49
69 0.43
70 0.38
71 0.33
72 0.3
73 0.34
74 0.39
75 0.36
76 0.41
77 0.47
78 0.53