Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E9K8

Protein Details
Accession A0A0D0E9K8   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-30ISHVWTRKRWKGSRKLPRGGAKRHRKILRDBasic
NLS Segment(s)
PositionSequence
7-51RKRWKGSRKLPRGGAKRHRKILRDNIQGITKPAIRRLARRGGVKR
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
IPR019809  Histone_H4_CS  
IPR004823  TAF_TATA-bd_Histone-like_dom  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF02969  TAF  
PROSITE View protein in PROSITE  
PS00047  HISTONE_H4  
CDD cd00076  H4  
Amino Acid Sequences ISHVWTRKRWKGSRKLPRGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTALDVVYALKRSGRTLYGFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.86
4 0.87
5 0.86
6 0.85
7 0.85
8 0.85
9 0.84
10 0.85
11 0.82
12 0.77
13 0.78
14 0.78
15 0.78
16 0.75
17 0.69
18 0.63
19 0.6
20 0.55
21 0.48
22 0.4
23 0.33
24 0.26
25 0.26
26 0.31
27 0.29
28 0.33
29 0.37
30 0.43
31 0.44
32 0.51
33 0.51
34 0.52
35 0.54
36 0.5
37 0.45
38 0.38
39 0.33
40 0.26
41 0.23
42 0.16
43 0.13
44 0.12
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.06
51 0.06
52 0.07
53 0.07
54 0.09
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.1
61 0.11
62 0.1
63 0.1
64 0.12
65 0.14
66 0.21
67 0.26
68 0.28
69 0.29
70 0.3
71 0.31
72 0.36
73 0.34
74 0.29
75 0.29
76 0.28
77 0.26
78 0.26
79 0.23
80 0.19
81 0.17
82 0.15
83 0.14
84 0.14
85 0.15
86 0.17
87 0.2
88 0.23