Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E233

Protein Details
Accession A0A0D0E233   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLSLKRCKHFELGGEKKTKGAALQFVRLLSTTPVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.89
9 0.88
10 0.88
11 0.89
12 0.86
13 0.87
14 0.87
15 0.82
16 0.76
17 0.73
18 0.63
19 0.57
20 0.54
21 0.54
22 0.53
23 0.51
24 0.54
25 0.53
26 0.57
27 0.59
28 0.62
29 0.57
30 0.58
31 0.62
32 0.61
33 0.63
34 0.61
35 0.6
36 0.59
37 0.61
38 0.52
39 0.47
40 0.43
41 0.35
42 0.37
43 0.38
44 0.36
45 0.3
46 0.37
47 0.4
48 0.48
49 0.57
50 0.59
51 0.58
52 0.62
53 0.69
54 0.7
55 0.68
56 0.64
57 0.59
58 0.56
59 0.54
60 0.49
61 0.44
62 0.41
63 0.35
64 0.3
65 0.28
66 0.27
67 0.32
68 0.38
69 0.42
70 0.45
71 0.54
72 0.61
73 0.67
74 0.64
75 0.58
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.5
82 0.54
83 0.5
84 0.47
85 0.46
86 0.39
87 0.31
88 0.26
89 0.28
90 0.27
91 0.32
92 0.33
93 0.32
94 0.32
95 0.3
96 0.27
97 0.22