Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EAZ0

Protein Details
Accession A0A0D0EAZ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33VPVPNLTKKSRGRRVPTANATNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MRKNARTLPIPVPVPNLTKKSRGRRVPTANATNPGRGQRDAALGARIYLCDVSGCGKCFARGEHLKRHIRSIHTYEKPHKCPYPGCGKEFSRHDNLGQHMKVHKDYPKVLECMKTGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.42
4 0.37
5 0.44
6 0.51
7 0.57
8 0.63
9 0.68
10 0.7
11 0.74
12 0.8
13 0.81
14 0.81
15 0.79
16 0.73
17 0.7
18 0.64
19 0.57
20 0.5
21 0.45
22 0.39
23 0.31
24 0.29
25 0.23
26 0.24
27 0.23
28 0.21
29 0.18
30 0.15
31 0.15
32 0.13
33 0.11
34 0.09
35 0.07
36 0.06
37 0.04
38 0.05
39 0.07
40 0.09
41 0.1
42 0.11
43 0.11
44 0.12
45 0.13
46 0.13
47 0.18
48 0.24
49 0.27
50 0.35
51 0.44
52 0.5
53 0.5
54 0.55
55 0.51
56 0.47
57 0.49
58 0.46
59 0.47
60 0.46
61 0.51
62 0.55
63 0.6
64 0.62
65 0.62
66 0.59
67 0.53
68 0.5
69 0.5
70 0.52
71 0.48
72 0.46
73 0.47
74 0.46
75 0.5
76 0.52
77 0.52
78 0.47
79 0.44
80 0.43
81 0.41
82 0.44
83 0.45
84 0.4
85 0.39
86 0.36
87 0.38
88 0.39
89 0.39
90 0.4
91 0.38
92 0.42
93 0.46
94 0.48
95 0.48
96 0.48
97 0.48
98 0.43