Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CXH9

Protein Details
Accession A0A0D0CXH9    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-59GPKTKLVKVTPGKKRPRKRSPRKSPPTGPDFQBasic
NLS Segment(s)
PositionSequence
28-52GPKTKLVKVTPGKKRPRKRSPRKSP
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MAKPKHIAVDAHSPVIEVKWKTIQTIRGPKTKLVKVTPGKKRPRKRSPRKSPPTGPDFQTYDQGDFHDMPDPLKFPSKTQNEFLREWQDHKELYLDILLQLEGPPEPQKCSHCLGDGTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.17
5 0.19
6 0.23
7 0.24
8 0.26
9 0.3
10 0.36
11 0.39
12 0.49
13 0.51
14 0.52
15 0.54
16 0.56
17 0.6
18 0.57
19 0.54
20 0.47
21 0.51
22 0.53
23 0.61
24 0.66
25 0.68
26 0.74
27 0.78
28 0.85
29 0.86
30 0.88
31 0.9
32 0.91
33 0.93
34 0.93
35 0.95
36 0.94
37 0.92
38 0.89
39 0.85
40 0.8
41 0.72
42 0.63
43 0.56
44 0.5
45 0.41
46 0.39
47 0.32
48 0.25
49 0.22
50 0.2
51 0.18
52 0.15
53 0.15
54 0.13
55 0.13
56 0.12
57 0.13
58 0.13
59 0.12
60 0.18
61 0.18
62 0.16
63 0.25
64 0.32
65 0.35
66 0.4
67 0.47
68 0.45
69 0.47
70 0.5
71 0.49
72 0.43
73 0.42
74 0.41
75 0.36
76 0.31
77 0.3
78 0.28
79 0.19
80 0.19
81 0.17
82 0.13
83 0.1
84 0.1
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.08
91 0.13
92 0.13
93 0.17
94 0.21
95 0.24
96 0.27
97 0.32
98 0.33
99 0.32
100 0.33