Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CPF6

Protein Details
Accession A0A0D0CPF6    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
1-32AGKRPKKEFGRPQRGKPERRRQKSPDYWEEEGBasic
NLS Segment(s)
PositionSequence
3-23KRPKKEFGRPQRGKPERRRQK
110-110R
112-112K
115-118PKGK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences AGKRPKKEFGRPQRGKPERRRQKSPDYWEEEGEREANEVDEEEDILRVLVEVIMGFSVQYQEVLTFELMWIRITMQTLAKAYVKGRVARQGGLDLGIGVNKPKREGLGSRMKTDPKGKVKKVDEDDDMEVVGEKEDDGDEDEDADVDGEVECLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.88
5 0.88
6 0.89
7 0.9
8 0.86
9 0.87
10 0.87
11 0.86
12 0.85
13 0.81
14 0.75
15 0.68
16 0.63
17 0.53
18 0.44
19 0.35
20 0.25
21 0.18
22 0.15
23 0.12
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.06
60 0.07
61 0.08
62 0.07
63 0.09
64 0.09
65 0.1
66 0.11
67 0.11
68 0.11
69 0.15
70 0.17
71 0.18
72 0.19
73 0.25
74 0.25
75 0.25
76 0.25
77 0.22
78 0.19
79 0.17
80 0.16
81 0.09
82 0.07
83 0.07
84 0.06
85 0.07
86 0.09
87 0.09
88 0.1
89 0.11
90 0.12
91 0.15
92 0.18
93 0.24
94 0.32
95 0.35
96 0.37
97 0.41
98 0.42
99 0.43
100 0.47
101 0.49
102 0.48
103 0.55
104 0.56
105 0.62
106 0.65
107 0.7
108 0.7
109 0.66
110 0.59
111 0.54
112 0.51
113 0.42
114 0.37
115 0.27
116 0.22
117 0.16
118 0.13
119 0.08
120 0.05
121 0.06
122 0.06
123 0.06
124 0.09
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.1
131 0.09
132 0.06
133 0.06
134 0.06