Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D3F3

Protein Details
Accession A0A0D0D3F3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-60TKTVKICKDKWKRLRSTYDTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, cyto_nucl 12.833, cyto_pero 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MITLVDLVVEHKAEVGDGLNFKTPFWSAVVTVLSPPCRGGTKTVKICKDKWKRLRSTYDTIKNICNTSGFMYLEGAGADIRDVNEDIYVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.1
5 0.11
6 0.16
7 0.16
8 0.16
9 0.17
10 0.16
11 0.15
12 0.15
13 0.15
14 0.1
15 0.13
16 0.13
17 0.12
18 0.13
19 0.14
20 0.14
21 0.13
22 0.13
23 0.11
24 0.12
25 0.13
26 0.17
27 0.23
28 0.3
29 0.38
30 0.44
31 0.49
32 0.51
33 0.54
34 0.59
35 0.62
36 0.64
37 0.66
38 0.69
39 0.7
40 0.74
41 0.8
42 0.76
43 0.75
44 0.74
45 0.73
46 0.68
47 0.62
48 0.59
49 0.51
50 0.45
51 0.37
52 0.28
53 0.21
54 0.2
55 0.22
56 0.18
57 0.16
58 0.16
59 0.16
60 0.15
61 0.13
62 0.11
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.08