Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E5Y8

Protein Details
Accession A0A0D0E5Y8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
76-95YKMQCARRKIREHHHAVPHDBasic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 11, nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVSRKKQAEDILTMMSEHCTVKFCHLDGKVDILKGHWCNECWTDEVFLSKNSKQKAFHIGSNSLCCQHVQSHYQLYKMQCARRKIREHHHAVPHDIVRAQQDAKKNTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.17
4 0.13
5 0.11
6 0.11
7 0.11
8 0.17
9 0.19
10 0.18
11 0.24
12 0.25
13 0.28
14 0.27
15 0.32
16 0.28
17 0.27
18 0.26
19 0.2
20 0.24
21 0.22
22 0.25
23 0.21
24 0.2
25 0.21
26 0.23
27 0.24
28 0.2
29 0.19
30 0.17
31 0.15
32 0.16
33 0.14
34 0.14
35 0.17
36 0.18
37 0.21
38 0.22
39 0.25
40 0.24
41 0.26
42 0.33
43 0.32
44 0.32
45 0.32
46 0.34
47 0.32
48 0.34
49 0.32
50 0.24
51 0.22
52 0.19
53 0.16
54 0.16
55 0.18
56 0.18
57 0.2
58 0.27
59 0.28
60 0.3
61 0.32
62 0.3
63 0.35
64 0.38
65 0.42
66 0.4
67 0.47
68 0.54
69 0.6
70 0.67
71 0.68
72 0.73
73 0.76
74 0.78
75 0.79
76 0.8
77 0.74
78 0.69
79 0.67
80 0.58
81 0.5
82 0.42
83 0.35
84 0.29
85 0.28
86 0.27
87 0.26
88 0.32