Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EBU5

Protein Details
Accession A0A0D0EBU5    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-37AAVKAKYTSKTKRNRSNTNDTRSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 13.833, cyto 7.5, cyto_pero 4.666
Family & Domain DBs
Amino Acid Sequences MSDPDITSTEQEQAAVKAKYTSKTKRNRSNTNDTRSEEQSDLGESNMSEEKRITASPEVASKTPGTLSGPKVVDVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.18
4 0.2
5 0.23
6 0.28
7 0.35
8 0.42
9 0.45
10 0.55
11 0.65
12 0.71
13 0.78
14 0.82
15 0.82
16 0.84
17 0.83
18 0.8
19 0.76
20 0.68
21 0.63
22 0.55
23 0.5
24 0.38
25 0.3
26 0.23
27 0.18
28 0.16
29 0.11
30 0.1
31 0.06
32 0.08
33 0.11
34 0.11
35 0.1
36 0.1
37 0.11
38 0.13
39 0.13
40 0.14
41 0.14
42 0.16
43 0.17
44 0.22
45 0.24
46 0.23
47 0.24
48 0.21
49 0.2
50 0.18
51 0.18
52 0.18
53 0.2
54 0.23
55 0.28
56 0.29