Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E3H3

Protein Details
Accession A0A0D0E3H3   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-48KPPPVLSSLPEKKKKKKNKASSNTPVGEHydrophilic
NLS Segment(s)
PositionSequence
31-40EKKKKKKNKA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MPASEIDDIFASRGKVNIVSKPPPVLSSLPEKKKKKKNKASSNTPVGEAPSSNKRSAPETVMDPSVQSVSKKRQKSVGSSNPTQPSSKDEFKRFKDSKGSGSRRKTEEGYHIYDEDELGISARGGDTPLCPFDCKCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.2
4 0.27
5 0.31
6 0.34
7 0.36
8 0.39
9 0.38
10 0.34
11 0.34
12 0.28
13 0.24
14 0.31
15 0.38
16 0.44
17 0.53
18 0.6
19 0.67
20 0.76
21 0.84
22 0.85
23 0.87
24 0.88
25 0.9
26 0.92
27 0.93
28 0.92
29 0.89
30 0.79
31 0.69
32 0.58
33 0.48
34 0.38
35 0.28
36 0.22
37 0.22
38 0.24
39 0.23
40 0.24
41 0.24
42 0.26
43 0.28
44 0.27
45 0.2
46 0.2
47 0.21
48 0.2
49 0.19
50 0.16
51 0.14
52 0.13
53 0.11
54 0.1
55 0.11
56 0.19
57 0.27
58 0.3
59 0.31
60 0.37
61 0.39
62 0.45
63 0.52
64 0.52
65 0.51
66 0.52
67 0.57
68 0.53
69 0.52
70 0.46
71 0.36
72 0.33
73 0.33
74 0.38
75 0.38
76 0.42
77 0.48
78 0.53
79 0.63
80 0.58
81 0.56
82 0.58
83 0.54
84 0.56
85 0.59
86 0.62
87 0.61
88 0.67
89 0.7
90 0.64
91 0.66
92 0.59
93 0.52
94 0.53
95 0.5
96 0.47
97 0.43
98 0.4
99 0.36
100 0.34
101 0.29
102 0.21
103 0.15
104 0.09
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.08
114 0.12
115 0.15
116 0.17
117 0.19
118 0.2