Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D6X1

Protein Details
Accession A0A0D0D6X1    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-50ATPVPSPPKCPRKTRRARSDQQSSGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPQDVRKVRFASEAMVYHLPAVNEATPVPSPPKCPRKTRRARSDQQSSGEGTSIDLHATEPQFPPISQLVVPAQPKPTKNKDFETTGHHARPGKLVIPAAPKTAGNQAIRPPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.26
4 0.23
5 0.23
6 0.2
7 0.15
8 0.16
9 0.12
10 0.11
11 0.11
12 0.12
13 0.11
14 0.13
15 0.16
16 0.15
17 0.21
18 0.3
19 0.4
20 0.44
21 0.54
22 0.62
23 0.69
24 0.79
25 0.84
26 0.85
27 0.85
28 0.88
29 0.86
30 0.87
31 0.8
32 0.72
33 0.63
34 0.53
35 0.43
36 0.35
37 0.26
38 0.16
39 0.12
40 0.09
41 0.07
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.08
48 0.1
49 0.11
50 0.11
51 0.13
52 0.12
53 0.13
54 0.11
55 0.13
56 0.12
57 0.16
58 0.17
59 0.16
60 0.2
61 0.23
62 0.26
63 0.32
64 0.4
65 0.43
66 0.47
67 0.51
68 0.51
69 0.51
70 0.51
71 0.52
72 0.49
73 0.48
74 0.45
75 0.43
76 0.41
77 0.38
78 0.4
79 0.34
80 0.3
81 0.26
82 0.26
83 0.26
84 0.31
85 0.31
86 0.29
87 0.28
88 0.26
89 0.25
90 0.31
91 0.34
92 0.29
93 0.31
94 0.35