Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0ECR3

Protein Details
Accession A0A0D0ECR3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-91RSTRARCNTRTTRRSRNRYHEQTSAQRSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 6, pero 2
Family & Domain DBs
Amino Acid Sequences MPQPGGVGRLITLFLLVFFKLLLGTASGKLASSKCHSASALALYYDFKASVISELHVKTRISGRSTRARCNTRTTRRSRNRYHEQTSAQRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.06
5 0.06
6 0.06
7 0.05
8 0.06
9 0.05
10 0.05
11 0.07
12 0.07
13 0.08
14 0.08
15 0.08
16 0.1
17 0.1
18 0.12
19 0.14
20 0.17
21 0.18
22 0.19
23 0.19
24 0.18
25 0.19
26 0.18
27 0.15
28 0.11
29 0.1
30 0.09
31 0.1
32 0.09
33 0.08
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.1
41 0.1
42 0.12
43 0.15
44 0.14
45 0.14
46 0.2
47 0.23
48 0.24
49 0.27
50 0.32
51 0.39
52 0.43
53 0.51
54 0.54
55 0.56
56 0.56
57 0.61
58 0.67
59 0.67
60 0.73
61 0.72
62 0.75
63 0.8
64 0.87
65 0.88
66 0.87
67 0.87
68 0.88
69 0.86
70 0.83
71 0.8
72 0.8