Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BWG0

Protein Details
Accession A0A0D0BWG0   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPSEKRKPRDKPKQYNRPAKKQKNKQDVPSTSHydrophilic
NLS Segment(s)
PositionSequence
5-24KRKPRDKPKQYNRPAKKQKN
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPSEKRKPRDKPKQYNRPAKKQKNKQDVPSTSAQPAQSTTRSNLTLSDWITVFAYIDSHPTVPQNCVVNHFRTLKSGALVFTQATLSRKLHSRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.94
4 0.93
5 0.93
6 0.93
7 0.93
8 0.92
9 0.93
10 0.93
11 0.9
12 0.88
13 0.87
14 0.8
15 0.74
16 0.68
17 0.6
18 0.5
19 0.46
20 0.37
21 0.27
22 0.25
23 0.23
24 0.21
25 0.2
26 0.2
27 0.2
28 0.21
29 0.21
30 0.19
31 0.18
32 0.19
33 0.17
34 0.16
35 0.13
36 0.12
37 0.12
38 0.11
39 0.09
40 0.06
41 0.06
42 0.05
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.15
51 0.17
52 0.17
53 0.22
54 0.25
55 0.26
56 0.3
57 0.32
58 0.29
59 0.28
60 0.31
61 0.26
62 0.25
63 0.23
64 0.19
65 0.16
66 0.17
67 0.14
68 0.13
69 0.13
70 0.14
71 0.14
72 0.18
73 0.18
74 0.2
75 0.26
76 0.29
77 0.34
78 0.36