Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DY96

Protein Details
Accession A0A0D0DY96   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-109EPKARKPKAAAPKPAKSKTKAPRPKSSDAEHydrophilic
NLS Segment(s)
PositionSequence
76-104NRGKEPKARKPKAAAPKPAKSKTKAPRPK
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTTTETSTKAATKRANAKNTKADKEDKPKRAPTAYNLFVQAQMKEWKVNNPGAPIKEAMVEIGALWRDAPENPNRGKEPKARKPKAAAPKPAKSKTKAPRPKSSDAEDSGEVSEWYAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.58
4 0.61
5 0.63
6 0.67
7 0.7
8 0.74
9 0.71
10 0.66
11 0.64
12 0.63
13 0.68
14 0.71
15 0.7
16 0.69
17 0.69
18 0.7
19 0.69
20 0.63
21 0.59
22 0.58
23 0.52
24 0.46
25 0.42
26 0.36
27 0.33
28 0.32
29 0.25
30 0.19
31 0.19
32 0.18
33 0.2
34 0.2
35 0.22
36 0.25
37 0.27
38 0.25
39 0.27
40 0.29
41 0.26
42 0.27
43 0.22
44 0.19
45 0.17
46 0.15
47 0.1
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.09
59 0.12
60 0.18
61 0.2
62 0.25
63 0.28
64 0.3
65 0.34
66 0.4
67 0.47
68 0.51
69 0.6
70 0.61
71 0.64
72 0.68
73 0.72
74 0.74
75 0.73
76 0.73
77 0.7
78 0.74
79 0.79
80 0.81
81 0.78
82 0.72
83 0.73
84 0.72
85 0.75
86 0.77
87 0.75
88 0.77
89 0.79
90 0.82
91 0.79
92 0.75
93 0.71
94 0.65
95 0.62
96 0.52
97 0.46
98 0.39
99 0.33
100 0.26