Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BWF6

Protein Details
Accession A0A0D0BWF6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
233-259GSMVGKVRPKPKPTKHKGKVVNLPEDEHydrophilic
NLS Segment(s)
PositionSequence
239-251VRPKPKPTKHKGK
Subcellular Location(s) plas 14, cyto 5, pero 3, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKYAPILFPHPDDLKPEDFLKRAELVQSGTFYKSSIDGAQAPGPKPKGRIWELRSTTAGMVSGAAVMAIFILSGDPNMFAKASSVFTFFNNSLFPASSSIKGAMDPDGTAATATNDWESAFGHRFDMEKNLWDSTPVSKSGSTVMVQPTPMPVPTPTPAPVPAAVTPTPMPPTVPGPVPPSISAAMQDLNIGLGHPQAPPPPALPVMGPTPILTMFIPPQAPPAPPHVELDDGSMVGKVRPKPKPTKHKGKVVNLPEDEPPVEVDNTSGTITARKSRQNIMKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.35
4 0.33
5 0.32
6 0.32
7 0.32
8 0.29
9 0.27
10 0.27
11 0.25
12 0.23
13 0.24
14 0.25
15 0.24
16 0.23
17 0.22
18 0.19
19 0.18
20 0.16
21 0.16
22 0.14
23 0.15
24 0.15
25 0.18
26 0.23
27 0.26
28 0.27
29 0.31
30 0.33
31 0.33
32 0.35
33 0.37
34 0.41
35 0.42
36 0.51
37 0.5
38 0.57
39 0.59
40 0.59
41 0.56
42 0.49
43 0.43
44 0.34
45 0.28
46 0.18
47 0.13
48 0.09
49 0.08
50 0.05
51 0.05
52 0.04
53 0.03
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.08
69 0.1
70 0.1
71 0.12
72 0.13
73 0.13
74 0.17
75 0.16
76 0.16
77 0.14
78 0.14
79 0.13
80 0.12
81 0.13
82 0.12
83 0.14
84 0.14
85 0.14
86 0.15
87 0.14
88 0.14
89 0.14
90 0.11
91 0.1
92 0.09
93 0.08
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.05
100 0.06
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.08
107 0.09
108 0.09
109 0.1
110 0.1
111 0.11
112 0.11
113 0.15
114 0.13
115 0.14
116 0.15
117 0.16
118 0.15
119 0.15
120 0.16
121 0.14
122 0.15
123 0.14
124 0.13
125 0.12
126 0.13
127 0.14
128 0.14
129 0.11
130 0.12
131 0.13
132 0.12
133 0.12
134 0.12
135 0.12
136 0.11
137 0.1
138 0.09
139 0.08
140 0.1
141 0.11
142 0.13
143 0.13
144 0.14
145 0.14
146 0.15
147 0.15
148 0.14
149 0.14
150 0.16
151 0.15
152 0.15
153 0.15
154 0.15
155 0.16
156 0.13
157 0.13
158 0.11
159 0.13
160 0.13
161 0.14
162 0.14
163 0.16
164 0.18
165 0.19
166 0.18
167 0.18
168 0.17
169 0.16
170 0.15
171 0.12
172 0.11
173 0.09
174 0.09
175 0.07
176 0.06
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.07
184 0.09
185 0.1
186 0.11
187 0.12
188 0.13
189 0.13
190 0.14
191 0.13
192 0.13
193 0.14
194 0.14
195 0.13
196 0.11
197 0.12
198 0.11
199 0.12
200 0.1
201 0.1
202 0.1
203 0.12
204 0.13
205 0.12
206 0.16
207 0.17
208 0.18
209 0.18
210 0.23
211 0.26
212 0.26
213 0.28
214 0.26
215 0.26
216 0.25
217 0.27
218 0.21
219 0.16
220 0.15
221 0.13
222 0.12
223 0.12
224 0.17
225 0.19
226 0.28
227 0.35
228 0.44
229 0.54
230 0.64
231 0.74
232 0.8
233 0.86
234 0.85
235 0.88
236 0.89
237 0.88
238 0.88
239 0.84
240 0.83
241 0.74
242 0.68
243 0.6
244 0.54
245 0.44
246 0.35
247 0.29
248 0.22
249 0.2
250 0.17
251 0.16
252 0.13
253 0.14
254 0.14
255 0.12
256 0.1
257 0.14
258 0.17
259 0.24
260 0.29
261 0.34
262 0.38
263 0.47