Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DTP2

Protein Details
Accession A0A0D0DTP2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-30WKSDWEPSRRVKCQERHRNCPRLRAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVSAWKSDWEPSRRVKCQERHRNCPRLRAGRSQVTTSISLSTQMASILHRKIRQYGIKTSMLRLSRLRVQRFPTTLYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.68
4 0.75
5 0.8
6 0.8
7 0.81
8 0.84
9 0.87
10 0.81
11 0.8
12 0.79
13 0.77
14 0.72
15 0.71
16 0.67
17 0.65
18 0.64
19 0.56
20 0.49
21 0.41
22 0.37
23 0.29
24 0.23
25 0.14
26 0.13
27 0.11
28 0.1
29 0.07
30 0.07
31 0.06
32 0.07
33 0.1
34 0.13
35 0.16
36 0.19
37 0.2
38 0.24
39 0.31
40 0.37
41 0.38
42 0.42
43 0.44
44 0.49
45 0.49
46 0.48
47 0.47
48 0.41
49 0.4
50 0.35
51 0.35
52 0.36
53 0.44
54 0.48
55 0.47
56 0.52
57 0.57
58 0.58