Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D5G7

Protein Details
Accession A0A0D0D5G7   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-44KAAAAPKKGKRHEPPKKPALVKBasic
NLS Segment(s)
PositionSequence
12-51KASSSKARHAAKAAAAPKKGKRHEPPKKPALVKEASMRKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGKTKGLQAKASSSKARHAAKAAAAPKKGKRHEPPKKPALVKEASMRKKYISLQALKAKVTKSIEQQMVSAASAGKLTIMKNAAPEPYVFLGNPSRAVRSRILREPAKGLKSARH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.51
4 0.53
5 0.54
6 0.48
7 0.45
8 0.42
9 0.39
10 0.45
11 0.45
12 0.43
13 0.42
14 0.45
15 0.48
16 0.54
17 0.56
18 0.58
19 0.61
20 0.66
21 0.73
22 0.79
23 0.81
24 0.8
25 0.84
26 0.78
27 0.72
28 0.67
29 0.59
30 0.51
31 0.49
32 0.5
33 0.48
34 0.47
35 0.44
36 0.37
37 0.37
38 0.37
39 0.36
40 0.33
41 0.3
42 0.34
43 0.39
44 0.4
45 0.38
46 0.38
47 0.31
48 0.28
49 0.28
50 0.24
51 0.22
52 0.27
53 0.29
54 0.28
55 0.27
56 0.24
57 0.22
58 0.19
59 0.16
60 0.09
61 0.07
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.09
68 0.11
69 0.11
70 0.13
71 0.15
72 0.15
73 0.14
74 0.14
75 0.15
76 0.15
77 0.16
78 0.14
79 0.15
80 0.18
81 0.18
82 0.23
83 0.21
84 0.24
85 0.25
86 0.29
87 0.33
88 0.37
89 0.43
90 0.46
91 0.53
92 0.53
93 0.55
94 0.59
95 0.61
96 0.56
97 0.54