Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CTF2

Protein Details
Accession A0A0D0CTF2   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-129YQCWTKQLRKGGRGRKRRRKPMQQRTLWRLPLKHydrophilic
NLS Segment(s)
PositionSequence
105-117RKGGRGRKRRRKP
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MKFVVDSRLLAFVLLNSLRKTLEWNMFTSVINTVEDSKLIFNAVETQITLEDMVWGFPTLDSTLKVSNKSSAHLPNATTWCNHHQQSGHNSDNCYAYQCWTKQLRKGGRGRKRRRKPMQQRTLWRLPLKLQRLQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.17
5 0.17
6 0.17
7 0.21
8 0.23
9 0.29
10 0.28
11 0.29
12 0.32
13 0.33
14 0.33
15 0.29
16 0.24
17 0.17
18 0.16
19 0.14
20 0.13
21 0.11
22 0.12
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.06
29 0.1
30 0.11
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.05
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.12
51 0.13
52 0.15
53 0.14
54 0.19
55 0.18
56 0.19
57 0.22
58 0.21
59 0.22
60 0.23
61 0.23
62 0.22
63 0.25
64 0.24
65 0.21
66 0.21
67 0.22
68 0.26
69 0.25
70 0.24
71 0.23
72 0.28
73 0.34
74 0.39
75 0.4
76 0.37
77 0.37
78 0.36
79 0.36
80 0.31
81 0.27
82 0.2
83 0.17
84 0.21
85 0.21
86 0.27
87 0.34
88 0.38
89 0.41
90 0.5
91 0.56
92 0.59
93 0.68
94 0.71
95 0.73
96 0.8
97 0.85
98 0.87
99 0.9
100 0.92
101 0.93
102 0.94
103 0.95
104 0.96
105 0.95
106 0.94
107 0.94
108 0.92
109 0.9
110 0.87
111 0.79
112 0.71
113 0.68
114 0.68
115 0.64