Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0EC48

Protein Details
Accession A0A0D0EC48   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-115ADAPPPNKNAKKRANQRAKKAAEKAEHydrophilic
NLS Segment(s)
PositionSequence
85-113KKAKGADAPPPNKNAKKRANQRAKKAAEK
Subcellular Location(s) nucl 17, cyto_nucl 12.333, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSRPPLFAEQTASGIAVDPRTLERVIPESKRSDGSVRKQIRVRPGFTPQEDVSRFRGTRQQAMDVTSLPKGHILGWVAPSSESQKKAKGADAPPPNKNAKKRANQRAKKAAEKAEAVKDSWEDEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.11
4 0.1
5 0.09
6 0.1
7 0.12
8 0.13
9 0.12
10 0.13
11 0.18
12 0.24
13 0.26
14 0.29
15 0.3
16 0.32
17 0.33
18 0.33
19 0.34
20 0.36
21 0.4
22 0.47
23 0.48
24 0.52
25 0.54
26 0.56
27 0.6
28 0.58
29 0.53
30 0.47
31 0.5
32 0.5
33 0.47
34 0.48
35 0.39
36 0.4
37 0.39
38 0.37
39 0.33
40 0.32
41 0.31
42 0.27
43 0.33
44 0.27
45 0.32
46 0.31
47 0.31
48 0.26
49 0.28
50 0.27
51 0.22
52 0.21
53 0.16
54 0.15
55 0.11
56 0.1
57 0.09
58 0.08
59 0.09
60 0.09
61 0.09
62 0.11
63 0.12
64 0.11
65 0.11
66 0.12
67 0.15
68 0.18
69 0.2
70 0.2
71 0.24
72 0.27
73 0.28
74 0.31
75 0.34
76 0.33
77 0.39
78 0.47
79 0.49
80 0.49
81 0.52
82 0.56
83 0.55
84 0.59
85 0.6
86 0.6
87 0.65
88 0.72
89 0.78
90 0.82
91 0.84
92 0.87
93 0.88
94 0.85
95 0.84
96 0.8
97 0.77
98 0.71
99 0.67
100 0.62
101 0.6
102 0.55
103 0.47
104 0.42
105 0.35
106 0.31