Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D0L8

Protein Details
Accession A0A0D0D0L8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
172-196TPPAVKAKPSSKSKHKGKAKATTTDHydrophilic
NLS Segment(s)
PositionSequence
177-191KAKPSSKSKHKGKAK
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR046521  DUF6698  
Pfam View protein in Pfam  
PF20414  DUF6698  
Amino Acid Sequences MPDFLKSARLIKILKVALFGKASLSGVHAPGPKTKGQIWELCSTSAGMVAAAAVMAIFSLSGDLNFYQVGNKTSIPYYQYHNYYCQQLLSGNPWSKSVFTFFNDTLFPATSSVVDAPKVPDSVDDDVDWEANFERAFEAGHPLNTVSAQPMPSYTTVLALAPSISSARPDLTPPAVKAKPSSKSKHKGKAKATTTDPDKAQPNNSVGEPGFNSTSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.32
4 0.3
5 0.3
6 0.27
7 0.2
8 0.18
9 0.18
10 0.14
11 0.16
12 0.14
13 0.14
14 0.18
15 0.2
16 0.2
17 0.25
18 0.28
19 0.27
20 0.29
21 0.32
22 0.34
23 0.36
24 0.4
25 0.39
26 0.42
27 0.41
28 0.38
29 0.35
30 0.28
31 0.23
32 0.18
33 0.14
34 0.08
35 0.06
36 0.05
37 0.04
38 0.04
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.03
48 0.03
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.09
56 0.11
57 0.11
58 0.12
59 0.13
60 0.14
61 0.15
62 0.16
63 0.16
64 0.19
65 0.23
66 0.26
67 0.26
68 0.29
69 0.3
70 0.3
71 0.29
72 0.24
73 0.19
74 0.16
75 0.16
76 0.15
77 0.2
78 0.2
79 0.2
80 0.21
81 0.21
82 0.21
83 0.2
84 0.19
85 0.15
86 0.13
87 0.17
88 0.16
89 0.17
90 0.16
91 0.16
92 0.15
93 0.13
94 0.12
95 0.08
96 0.08
97 0.07
98 0.07
99 0.08
100 0.07
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.08
107 0.08
108 0.11
109 0.13
110 0.14
111 0.12
112 0.12
113 0.12
114 0.12
115 0.11
116 0.08
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.05
123 0.06
124 0.06
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.11
131 0.11
132 0.11
133 0.08
134 0.09
135 0.09
136 0.09
137 0.09
138 0.11
139 0.11
140 0.13
141 0.11
142 0.11
143 0.11
144 0.11
145 0.1
146 0.08
147 0.08
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.09
155 0.1
156 0.11
157 0.14
158 0.19
159 0.22
160 0.23
161 0.31
162 0.31
163 0.32
164 0.35
165 0.39
166 0.43
167 0.48
168 0.55
169 0.57
170 0.66
171 0.75
172 0.8
173 0.83
174 0.84
175 0.84
176 0.86
177 0.82
178 0.79
179 0.75
180 0.73
181 0.69
182 0.66
183 0.58
184 0.53
185 0.52
186 0.48
187 0.47
188 0.44
189 0.41
190 0.38
191 0.36
192 0.35
193 0.3
194 0.3
195 0.27
196 0.25
197 0.24