Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DY55

Protein Details
Accession A0A0D0DY55   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTNHNQNRKAHRNGIKRPKTNRTRSLKHydrophilic
NLS Segment(s)
PositionSequence
14-41RKAHRNGIKRPKTNRTRSLKGVDPKFRK
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKRPKTNRTRSLKGVDPKFRKNALYALVGSRKARAEKEETTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.82
8 0.82
9 0.81
10 0.82
11 0.83
12 0.83
13 0.82
14 0.81
15 0.79
16 0.74
17 0.71
18 0.68
19 0.65
20 0.62
21 0.62
22 0.61
23 0.59
24 0.59
25 0.59
26 0.57
27 0.51
28 0.45
29 0.41
30 0.34
31 0.32
32 0.27
33 0.28
34 0.29
35 0.31
36 0.3
37 0.29
38 0.3
39 0.3
40 0.32
41 0.32
42 0.34