Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E957

Protein Details
Accession A0A0D0E957    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-157QRAMPRGPMFPRRRRRRARRTPVEVTQAAHydrophilic
NLS Segment(s)
PositionSequence
136-148PMFPRRRRRRARR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MELLPVDVRDSHSSLSVESHESIRQATPVPQPSSRLQPRPASRLSFLSTGRPQLRSAEIPKLSKSDLIRAYTLQHAESGLGNDYLKRKNVIRVRLEGEQFLLQAHDVPAVVGWIEGIHAGTNIALDLDQRAMPRGPMFPRRRRRRARRTPVEVTQAAAIVSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.19
4 0.19
5 0.18
6 0.19
7 0.17
8 0.18
9 0.19
10 0.17
11 0.17
12 0.16
13 0.19
14 0.25
15 0.31
16 0.35
17 0.35
18 0.38
19 0.4
20 0.48
21 0.51
22 0.5
23 0.48
24 0.52
25 0.56
26 0.59
27 0.6
28 0.54
29 0.48
30 0.46
31 0.43
32 0.39
33 0.34
34 0.34
35 0.32
36 0.35
37 0.35
38 0.33
39 0.3
40 0.29
41 0.32
42 0.29
43 0.3
44 0.31
45 0.32
46 0.32
47 0.33
48 0.32
49 0.29
50 0.29
51 0.26
52 0.25
53 0.25
54 0.26
55 0.25
56 0.24
57 0.25
58 0.24
59 0.24
60 0.17
61 0.13
62 0.11
63 0.11
64 0.1
65 0.09
66 0.07
67 0.07
68 0.07
69 0.08
70 0.11
71 0.12
72 0.13
73 0.14
74 0.14
75 0.22
76 0.28
77 0.34
78 0.35
79 0.38
80 0.41
81 0.43
82 0.43
83 0.35
84 0.31
85 0.23
86 0.19
87 0.15
88 0.12
89 0.07
90 0.07
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.04
113 0.05
114 0.06
115 0.08
116 0.08
117 0.11
118 0.11
119 0.13
120 0.14
121 0.19
122 0.24
123 0.33
124 0.42
125 0.5
126 0.61
127 0.71
128 0.8
129 0.86
130 0.91
131 0.92
132 0.94
133 0.95
134 0.95
135 0.93
136 0.91
137 0.88
138 0.85
139 0.74
140 0.64
141 0.54
142 0.43
143 0.34