Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DYZ2

Protein Details
Accession A0A0D0DYZ2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MMPEKRKPREKPTKYTRSAKRQKVKDAPNTSTHydrophilic
NLS Segment(s)
PositionSequence
5-24KRKPREKPTKYTRSAKRQKV
Subcellular Location(s) nucl 20, mito_nucl 12.833, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MMPEKRKPREKPTKYTRSAKRQKVKDAPNTSTQPAKSTSRQNPTLGDWLTIYAYINFHPSISQLDVVTHFQTLRTGALVFTQSMLSRKLWECPKLEACINDNPWSGEGIGSLGQTHGEQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.87
5 0.89
6 0.88
7 0.87
8 0.85
9 0.87
10 0.86
11 0.85
12 0.85
13 0.82
14 0.76
15 0.74
16 0.7
17 0.61
18 0.57
19 0.48
20 0.4
21 0.36
22 0.36
23 0.33
24 0.39
25 0.45
26 0.47
27 0.5
28 0.49
29 0.47
30 0.45
31 0.47
32 0.37
33 0.3
34 0.22
35 0.19
36 0.18
37 0.15
38 0.13
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.1
53 0.11
54 0.11
55 0.1
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.08
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.12
72 0.11
73 0.15
74 0.16
75 0.22
76 0.28
77 0.32
78 0.33
79 0.38
80 0.41
81 0.4
82 0.42
83 0.38
84 0.36
85 0.39
86 0.4
87 0.37
88 0.34
89 0.32
90 0.3
91 0.28
92 0.24
93 0.16
94 0.13
95 0.11
96 0.1
97 0.09
98 0.09
99 0.08
100 0.09