Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HPZ6

Protein Details
Accession C6HPZ6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42ESQVEKKRVRRLKPSKQPDHSBasic
NLS Segment(s)
PositionSequence
29-32RVRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHLVSIDAEHSNIYQVKLCEDESQVEKKRVRRLKPSKQPDHSVSVSLYSCMKTRSSRAESETAPIVHSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.18
5 0.19
6 0.18
7 0.18
8 0.2
9 0.2
10 0.28
11 0.3
12 0.34
13 0.37
14 0.4
15 0.48
16 0.53
17 0.55
18 0.58
19 0.65
20 0.7
21 0.77
22 0.82
23 0.82
24 0.8
25 0.8
26 0.72
27 0.68
28 0.58
29 0.49
30 0.38
31 0.32
32 0.26
33 0.21
34 0.19
35 0.13
36 0.14
37 0.14
38 0.16
39 0.17
40 0.21
41 0.3
42 0.34
43 0.38
44 0.42
45 0.45
46 0.43
47 0.44
48 0.44
49 0.35