Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0ECT2

Protein Details
Accession A0A0D0ECT2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-92NMSWGSGKPSKSKRFKRRSFGLFHydrophilic
NLS Segment(s)
PositionSequence
77-87KPSKSKRFKRR
Subcellular Location(s) nucl 12.5, mito_nucl 12.166, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MSPLSYFKRDSVSSTKSSRSSTSSNSPVLVYGGHPSPLDITYAVNIQPWSPRAPGSSDEGGYAKMLDDDNMSWGSGKPSKSKRFKRRSFGLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.43
4 0.45
5 0.42
6 0.39
7 0.37
8 0.37
9 0.41
10 0.4
11 0.38
12 0.36
13 0.34
14 0.29
15 0.25
16 0.2
17 0.13
18 0.1
19 0.1
20 0.1
21 0.1
22 0.09
23 0.1
24 0.1
25 0.1
26 0.08
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.08
35 0.09
36 0.11
37 0.11
38 0.12
39 0.12
40 0.14
41 0.15
42 0.19
43 0.19
44 0.18
45 0.18
46 0.18
47 0.17
48 0.15
49 0.13
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.07
56 0.1
57 0.1
58 0.1
59 0.1
60 0.1
61 0.15
62 0.18
63 0.2
64 0.27
65 0.36
66 0.47
67 0.57
68 0.68
69 0.74
70 0.81
71 0.89
72 0.9