Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DL44

Protein Details
Accession A0A0D0DL44    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MMPEKCKPRKKPTKYTWSAKRQKVNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 13.166, cyto_nucl 11.166, mito 7
Family & Domain DBs
Amino Acid Sequences MMPEKCKPRKKPTKYTWSAKRQKVNDAPNTSTQPAKSTSCQNLTLGDWLTIYAYINSHPSISQLDVVTHFQTLRTGALVFTQSMLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.9
4 0.9
5 0.9
6 0.87
7 0.85
8 0.77
9 0.77
10 0.75
11 0.74
12 0.72
13 0.68
14 0.63
15 0.58
16 0.59
17 0.5
18 0.43
19 0.35
20 0.28
21 0.25
22 0.25
23 0.22
24 0.24
25 0.27
26 0.29
27 0.29
28 0.28
29 0.26
30 0.23
31 0.23
32 0.17
33 0.13
34 0.1
35 0.08
36 0.08
37 0.07
38 0.07
39 0.05
40 0.05
41 0.06
42 0.07
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.11
49 0.13
50 0.12
51 0.13
52 0.14
53 0.17
54 0.16
55 0.15
56 0.14
57 0.12
58 0.13
59 0.13
60 0.12
61 0.11
62 0.1
63 0.1
64 0.12
65 0.14
66 0.13